HORDB

ID: hor001575
Uniprot ID: P41876
Protein name: APPSDFMRF-amide
Gene name: FMRFa
Organism: Drosophila virilis (Fruit fly)
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: virilis group, Drosophila (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0002209 behavioral defense response; GO:0006942 regulation of striated muscle contraction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008344 adult locomotory behavior; GO:0008345 larval locomotory behavior; GO:0010459 negative regulation of heart rate; GO:0045822 negative regulation of heart contraction; GO:1900075 positive regulation of neuromuscular synaptic transmission
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: APPSDFMRF
Length: 9(164-172)
Propeptide: MGIALMFLLALYQMQSAIHSEIIETPSSYNDNSLLEAAAEEPNSRATASESDLLDGLMSTDNPNPEQQTELEFRYPISAIGIGYAKNSVVLRFQKHARKQNFKYDPDYEMKRKSLQDNFMHFGKRQAEQLPQATGPGYYECIKRSAMDRYGRDPKQDFMRFGRAPPSDFMRFGRAPSDFMRFGRDPSQDFMRFGRSDNFMRFGRNLNFHEELRSPKQDFMRFGRPDNFMRFGRSAPTEFERNGKMDSNFMRFGKR
Signal peptide: MGIALMFLLALYQMQSAIHSEI
Modification: T9 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001575_AF2.pdb

hor001575_ESM.pdb

Mass:	121009	Formula:	C49H70N12O13S
Absent amino acids:	CEGHIKLNQTVWY	Common amino acids:	FP
pI:	6.34	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	3
Hydrophobicity:	-30	Boman Index:	-1692
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	11.11
Instability Index:	5633.33	Extinction Coefficient cystines:	0
Absorbance 280nm:	0